PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G087600.1
Common NameB456_005G087600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MIKC_MADS
Protein Properties Length: 263aa    MW: 30620.4 Da    PI: 9.4959
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G087600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.4e-2959109151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+s+gk++ey+s
  Gorai.005G087600.1  59 KRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAKVSLIIFASSGKMHEYCS 109
                         79***********************************************96 PP

2K-box87.42.9e-29121217197
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yqk+sgk+l++ak+e+l++e++++kke++++q e+Rhl+Ged++sL +keL+ Le++Le++l+ +R+k++++l +  ++++  e+++++ n
  Gorai.005G087600.1 121 YQKTSGKKLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLPYKELMALEDALENGLTCVRAKQMDVLDMAKKNTKFLEEDNKQLN 211
                         899***************************************************************************************9 PP

               K-box  92 kaLrkk 97 
                            +++
  Gorai.005G087600.1 212 FIVNQQ 217
                         988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-4151110IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.53451111IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.24E-3652146IPR002100Transcription factor, MADS-box
CDDcd002651.13E-4152130No hitNo description
PRINTSPR004041.5E-285373IPR002100Transcription factor, MADS-box
PROSITE patternPS00350053107IPR002100Transcription factor, MADS-box
PfamPF003198.1E-2360107IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-287388IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-2888109IPR002100Transcription factor, MADS-box
PfamPF014863.7E-19132211IPR002487Transcription factor, K-box
PROSITE profilePS5129714.242134220IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MQISKPEIEC LKLLVFLSWL LSLNLILCSI PHHFTTKKHQ SKEVEREKSK MGRGKIEIKR  60
IENSSNRQVT YSKRRNGIMK KAKEITVLCD AKVSLIIFAS SGKMHEYCSP STKLIDILDQ  120
YQKTSGKKLW DAKHENLSNE IDRIKKENDS MQIELRHLKG EDITSLPYKE LMALEDALEN  180
GLTCVRAKQM DVLDMAKKNT KFLEEDNKQL NFIVNQQQLT YENVREHMDH HGYHRAARAD  240
FNSQMPFAFR VQPMQPNLQE RM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-1652110159Myocyte-specific enhancer factor 2A
3mu6_C2e-1652110159Myocyte-specific enhancer factor 2A
3mu6_B2e-1652110159Myocyte-specific enhancer factor 2A
3mu6_A2e-1652110159Myocyte-specific enhancer factor 2A
3p57_J3e-1652139180Myocyte-specific enhancer factor 2A
3p57_I3e-1652139180Myocyte-specific enhancer factor 2A
3p57_D3e-1652139180Myocyte-specific enhancer factor 2A
3p57_C3e-1652139180Myocyte-specific enhancer factor 2A
3p57_B3e-1652139180Myocyte-specific enhancer factor 2A
3p57_A3e-1652139180Myocyte-specific enhancer factor 2A
3kov_J3e-1652139180Myocyte-specific enhancer factor 2A
3kov_I3e-1652139180Myocyte-specific enhancer factor 2A
3kov_B3e-1652139180Myocyte-specific enhancer factor 2A
3kov_A3e-1652139180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4098690.0FJ409869.1 Gossypium hirsutum MADS-12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482533.11e-159PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074741e-105MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0D2N9L70.0A0A0D2N9L7_G
STRINGVIT_18s0001g01760.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-90MIKC_MADS family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]